Pxmp3 Peptide - N-terminal region
Pxmp3 Peptide - N-terminal region
Product Specifications
Product Name Alternative
35kDa, D3Ertd138e, PMP35, Pex2, Pxmp3
UniProt
P55098
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Pxmp3 Rabbit Polyclonal Antibody (orb578658) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_033020
Preservative
Lyophilized powder
AA Sequence
MQSANRVLRISQLDALELNKALEQLVWSQFTQCFHGFKPGLLARFEPEVK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![C3orf25 (EFCAB12) Mouse Monoclonal Antibody [Clone ID: OTI6C7]](https://cdn.genprice.uk/products/937/68dd18bb061270361e908c67/imageurl/cf811972.webp)
CF811972 100 µg
C3orf25 (EFCAB12) Mouse Monoclonal Antibody [Clone ID: OTI6C7]
Sign In for Pricing
View Details 
TRC-M525115-50MG 50 mg
Monobutyl Phthalate Acyl-Beta-D-glucuronide Benzyl Ester
Sign In for Pricing
View Details ![ELL Mouse Monoclonal Antibody [Clone ID: OTI3E9]](https://cdn.genprice.uk/products/937/68dd18bb061270361e908984/imageurl/cf810825.webp)
AP51916PU-N 400 µL
GPR133 (ADGRD1) (Center) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 