Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pxmp3 Peptide - N-terminal region

Pxmp3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

35kDa, D3Ertd138e, PMP35, Pex2, Pxmp3

UniProt

P55098

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pxmp3 Rabbit Polyclonal Antibody (orb578658) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033020

Preservative

Lyophilized powder

AA Sequence

MQSANRVLRISQLDALELNKALEQLVWSQFTQCFHGFKPGLLARFEPEVK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PerCP/Cyanine5.5 Anti-Mouse CD5 Antibody
RD22035F-01 25 µg

PerCP/Cyanine5.5 Anti-Mouse CD5 Antibody

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD5 Antibody
RD22035F-02 100 µg

PerCP/Cyanine5.5 Anti-Mouse CD5 Antibody

Sign In for Pricing
View Details
CD33 (C33/69), 1mg/mL
BNUM0069-50 1x 50 µL

CD33 (C33/69), 1mg/mL

Sign In for Pricing
View Details
RFC3 Rabbit Polyclonal Antibody
AP20631PU-N 100 µg

RFC3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HMG20A Human Gene Knockout Kit (CRISPR)
KN401894 1 Kit

HMG20A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human UBE2M/UBC12 Protein
PKSH033478-01 10 µg

Recombinant Human UBE2M/UBC12 Protein

Sign In for Pricing
View Details