Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

QARS Peptide - N-terminal region

QARS Peptide - N-terminal region

Product Specifications

Product Name Alternative

GLNRS, PRO2195

UniProt

P47897

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with QARS Rabbit Polyclonal Antibody (orb583240) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005042

Preservative

Lyophilized powder

AA Sequence

DQTLSLMEQLRGEALKFHKPGENYKTPGYVVTPHTMNLLKQHLEITGGQV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Poly(ethylene Glycol) ~30,000
TRC-P688378-500MG 500 mg

Poly(ethylene Glycol) ~30,000

Sign In for Pricing
View Details
Human SEP15 activation kit by CRISPRa
GA106275 1 Kit

Human SEP15 activation kit by CRISPRa

Sign In for Pricing
View Details
Human SPRN activation kit by CRISPRa
GA118598 1 Kit

Human SPRN activation kit by CRISPRa

Sign In for Pricing
View Details
IGF2R Human Gene Knockout Kit (CRISPR)
KN415594 1 Kit

IGF2R Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS701411 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
CD95 / FAS / TNFRSF6 (FAS/3112), CF740 conjugate, 0.1mg/mL
BNC743112-100 1x 100 µL

CD95 / FAS / TNFRSF6 (FAS/3112), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details