Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB11FIP2 Peptide - N-terminal region

RAB11FIP2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

KIAA0941, Rab11-FIP2, nRip11

UniProt

Q7L804

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAB11FIP2 Rabbit Polyclonal Antibody (orb582630) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055719

Preservative

Lyophilized powder

AA Sequence

LLIQGSPEKYILFLIVMHRSLVGLDKFLGQVAINLNDIFEDKQRRKTEWF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Regulator of G-protein signaling 10, RGS10 ELISA Kit
MBS9335625-01 48 Well

Bovine Regulator of G-protein signaling 10, RGS10 ELISA Kit

Sign In for Pricing
View Details
Bovine Regulator of G-protein signaling 10, RGS10 ELISA Kit
MBS9335625-02 96 Well

Bovine Regulator of G-protein signaling 10, RGS10 ELISA Kit

Sign In for Pricing
View Details
Bovine Regulator of G-protein signaling 10, RGS10 ELISA Kit
MBS9335625-03 5x 96 Well

Bovine Regulator of G-protein signaling 10, RGS10 ELISA Kit

Sign In for Pricing
View Details
Bovine Regulator of G-protein signaling 10, RGS10 ELISA Kit
MBS9335625-04 10x 96 Well

Bovine Regulator of G-protein signaling 10, RGS10 ELISA Kit

Sign In for Pricing
View Details
ISOC2 Rabbit Polyclonal Antibody
TA359966 100 µL

ISOC2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ta-0910 Taltirelin Peptide
PE-100286-01 1 mg

Ta-0910 Taltirelin Peptide

Sign In for Pricing
View Details