Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB11FIP2 Peptide - N-terminal region

RAB11FIP2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

KIAA0941, Rab11-FIP2, nRip11

UniProt

Q7L804

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAB11FIP2 Rabbit Polyclonal Antibody (orb582630) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055719

Preservative

Lyophilized powder

AA Sequence

LLIQGSPEKYILFLIVMHRSLVGLDKFLGQVAINLNDIFEDKQRRKTEWF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kif4 Mouse qPCR Primer Pair (NM_008446)
MP207183 200 Reactions

Kif4 Mouse qPCR Primer Pair (NM_008446)

Sign In for Pricing
View Details
VMAC Protein Lysate (Mouse) with C-HA Tag
49517035 100 µg

VMAC Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Mouse Adiponectin PicoKine Fast ELISA Kit
MBS1752741-01 96 Well

Mouse Adiponectin PicoKine Fast ELISA Kit

Sign In for Pricing
View Details
Mouse Adiponectin PicoKine Fast ELISA Kit
MBS1752741-02 5x 96 Well

Mouse Adiponectin PicoKine Fast ELISA Kit

Sign In for Pricing
View Details
TMEM140 sgRNA CRISPR Lentivector (Human) (Target 2)
K2399703 1.0 µg DNA

TMEM140 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Pgm2 (NM_028132) Mouse Tagged ORF Clone
MR208909 10 µg

Pgm2 (NM_028132) Mouse Tagged ORF Clone

Sign In for Pricing
View Details