Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB11FIP5 Peptide - N-terminal region

RAB11FIP5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp434H018, GAF1, KIAA0857, RIP11, pp75

UniProt

Q9BXF6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAB11FIP5 Rabbit Polyclonal Antibody (orb582684) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056285

Preservative

Lyophilized powder

AA Sequence

MALVRGAEPAAGPSRWLPTHVQVTVLRARGLRGKSSGAGSTSDAYTVIQV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX2 (Embryonic Stem Cell Marker) (SOX2/3169R), CF488A conjugate, 0.1mg/mL
BNC883169-100 1x 100 µL

SOX2 (Embryonic Stem Cell Marker) (SOX2/3169R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IFluor® 810 maleimide
1388-AAT 1 mg

IFluor® 810 maleimide

Sign In for Pricing
View Details
Human MAN1C1 activation kit by CRISPRa
GA111397 1 Kit

Human MAN1C1 activation kit by CRISPRa

Sign In for Pricing
View Details
Diphacinone-d4 (indanedione-4,5,6,7-d4)
TRC-D486961-5MG 5 mg

Diphacinone-d4 (indanedione-4,5,6,7-d4)

Sign In for Pricing
View Details
Xylobiose
TRC-X750400-10MG 10 mg

Xylobiose

Sign In for Pricing
View Details
Dual Caspase 3/7 and Mitochondrial Membrane Potential Assay Kit
MITCAP200-2 100 Tests

Dual Caspase 3/7 and Mitochondrial Membrane Potential Assay Kit

Sign In for Pricing
View Details