Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB11FIP5 Peptide - N-terminal region

RAB11FIP5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp434H018, GAF1, KIAA0857, RIP11, pp75

UniProt

Q9BXF6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAB11FIP5 Rabbit Polyclonal Antibody (orb582684) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056285

Preservative

Lyophilized powder

AA Sequence

MALVRGAEPAAGPSRWLPTHVQVTVLRARGLRGKSSGAGSTSDAYTVIQV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Phenyl-1H-1,2,3-triazole-4-carboxylic Acid
TRC-P322408-10MG 10 mg

5-Phenyl-1H-1,2,3-triazole-4-carboxylic Acid

Sign In for Pricing
View Details
PTRH2 Rabbit Polyclonal Antibody
TA369292 100 µL

PTRH2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Calpastatin (CAST/1550), 1mg/mL
BNUM1550-50 1x 50 µL

Calpastatin (CAST/1550), 1mg/mL

Sign In for Pricing
View Details
GDI2 Rabbit Polyclonal Antibody
TA376534 100 µL

GDI2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CA150 (TCERG1) Human Gene Knockout Kit (CRISPR)
KN217192BN 1 Kit

CA150 (TCERG1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Mouse SerpinD1/HCF2 Protein (His Tag)
PKSM040854 50 µg

Recombinant Mouse SerpinD1/HCF2 Protein (His Tag)

Sign In for Pricing
View Details