Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rab13 Peptide - middle region

Rab13 Peptide - middle region

Product Specifications

Product Name Alternative

0610007N03Rik, B230212B15Rik

UniProt

Q9DD03

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rab13 Rabbit Polyclonal Antibody (orb578639) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_080953

Preservative

Lyophilized powder

AA Sequence

TDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRQVQREQAEKLA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse tRNA-dihydrouridine synthase 4-like, DUS4L ELISA Kit
MBS9316870-01 48 Well

Mouse tRNA-dihydrouridine synthase 4-like, DUS4L ELISA Kit

Sign In for Pricing
View Details
Mouse tRNA-dihydrouridine synthase 4-like, DUS4L ELISA Kit
MBS9316870-02 96 Well

Mouse tRNA-dihydrouridine synthase 4-like, DUS4L ELISA Kit

Sign In for Pricing
View Details
Mouse tRNA-dihydrouridine synthase 4-like, DUS4L ELISA Kit
MBS9316870-03 5x 96 Well

Mouse tRNA-dihydrouridine synthase 4-like, DUS4L ELISA Kit

Sign In for Pricing
View Details
Mouse tRNA-dihydrouridine synthase 4-like, DUS4L ELISA Kit
MBS9316870-04 10x 96 Well

Mouse tRNA-dihydrouridine synthase 4-like, DUS4L ELISA Kit

Sign In for Pricing
View Details
PREB Rabbit mAb
MBS8602145-01 0.1 mL

PREB Rabbit mAb

Sign In for Pricing
View Details
PREB Rabbit mAb
MBS8602145-02 0.1 mL (AF405L)

PREB Rabbit mAb

Sign In for Pricing
View Details