Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rab13 Peptide - middle region

Rab13 Peptide - middle region

Product Specifications

Product Name Alternative

0610007N03Rik, B230212B15Rik

UniProt

Q9DD03

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rab13 Rabbit Polyclonal Antibody (orb578639) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_080953

Preservative

Lyophilized powder

AA Sequence

TDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRQVQREQAEKLA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat FGF18 Protein, His (Fc)-Avi-tagged
FGF18-1987R 50 µg

Recombinant Rat FGF18 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Lentiviral mouse Lor shRNA (UAS) - Lentiviral mouse Lor shRNA (UAS) plasmid
GTR15239707 1 Vial

Lentiviral mouse Lor shRNA (UAS) - Lentiviral mouse Lor shRNA (UAS) plasmid

Sign In for Pricing
View Details
Rat Monoclonal mouse TNFRSF7 Antibody
orb1152702 100 µg

Rat Monoclonal mouse TNFRSF7 Antibody

Sign In for Pricing
View Details
Rabbit Anti TNRC6A Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Immunofluorescence) 120ul
IRBAMLTNRC6AAP096120UL 120 µL

Rabbit Anti TNRC6A Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Immunofluorescence) 120ul

Sign In for Pricing
View Details
Anti-TFEB Antibody Picoband®, Carrier-free
A00662-3-carrier-free 100 µg/Vial

Anti-TFEB Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
Anti-alpha Tubulin (acetyl K40) Rabbit Monoclonal Antibody
MBS1760087-01 0.03 mL

Anti-alpha Tubulin (acetyl K40) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details