Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB15 Peptide - middle region

RAB15 Peptide - middle region

Product Specifications

UniProt

P59190

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAB15 Rabbit Polyclonal Antibody (orb326053) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_941959

Preservative

Lyophilized powder

AA Sequence

QTITKQYYRRAQGIFLVYDISSERSYQHIMKWVSDVDEVGDATSLPGCGE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hepsin/TMPRSS1 Polyclonal Antibody, PE Conjugated
bs-6281R-PE 100 µL

Hepsin/TMPRSS1 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae ER membrane protein complex subunit 3 (AIM27)
MBS7007502-01 0.02 mg

Recombinant Saccharomyces cerevisiae ER membrane protein complex subunit 3 (AIM27)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae ER membrane protein complex subunit 3 (AIM27)
MBS7007502-02 0.1 mg

Recombinant Saccharomyces cerevisiae ER membrane protein complex subunit 3 (AIM27)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae ER membrane protein complex subunit 3 (AIM27)
MBS7007502-03 5x 0.1 mg

Recombinant Saccharomyces cerevisiae ER membrane protein complex subunit 3 (AIM27)

Sign In for Pricing
View Details
Recombinant Human NTNG1/Netrin-G1 Protein, C-Strep
bs-104308P-01 20 µg

Recombinant Human NTNG1/Netrin-G1 Protein, C-Strep

Sign In for Pricing
View Details
Recombinant Human NTNG1/Netrin-G1 Protein, C-Strep
bs-104308P-02 50 µg

Recombinant Human NTNG1/Netrin-G1 Protein, C-Strep

Sign In for Pricing
View Details