Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rab23 Peptide - middle region

Rab23 Peptide - middle region

Product Specifications

Product Name Alternative

AW545388, opb, opb2

UniProt

P35288

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rab23 Rabbit Polyclonal Antibody (orb330900) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033025

Preservative

Lyophilized powder

AA Sequence

DPEQTHSSSNKIGVFNASVRSHLGQNSSSLNGGDVINLRPNKQRTKRTRN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TBC1 Domain Family, Member 10C (TBC1D10C) ELISA Kit
201-12-5072 96 Tests

Human TBC1 Domain Family, Member 10C (TBC1D10C) ELISA Kit

Sign In for Pricing
View Details
(R) -2-Hydroxy-2-phenylacetohydrazide
OR350337-01 5 g

(R) -2-Hydroxy-2-phenylacetohydrazide

Sign In for Pricing
View Details
(R) -2-Hydroxy-2-phenylacetohydrazide
OR350337-02 10 g

(R) -2-Hydroxy-2-phenylacetohydrazide

Sign In for Pricing
View Details
(R) -2-Hydroxy-2-phenylacetohydrazide
OR350337-03 25 g

(R) -2-Hydroxy-2-phenylacetohydrazide

Sign In for Pricing
View Details
Osmolality Std 600mOsm/kg H2O
RE-OSM-600 12 / PCK

Osmolality Std 600mOsm/kg H2O

Sign In for Pricing
View Details
Anti-TIF1/TRIM24 IP (SAA0265) (Mouse, Monoclonal, IgG2a)
A133003 100 µL

Anti-TIF1/TRIM24 IP (SAA0265) (Mouse, Monoclonal, IgG2a)

Sign In for Pricing
View Details