Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rab23 Peptide - middle region

Rab23 Peptide - middle region

Product Specifications

Product Name Alternative

AW545388, opb, opb2

UniProt

P35288

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rab23 Rabbit Polyclonal Antibody (orb330900) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033025

Preservative

Lyophilized powder

AA Sequence

DPEQTHSSSNKIGVFNASVRSHLGQNSSSLNGGDVINLRPNKQRTKRTRN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kif23 3'UTR Luciferase Stable Cell Line
TU110560 1.0 mL

Kif23 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Chicken Immunoglobulin E, IgE ELISA Kit
QY-E80029 96 Tests

Chicken Immunoglobulin E, IgE ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse 4933434E20Rik shRNA (UAS) - Lentiviral mouse 4933434E20Rik shRNA (UAS, iRFP) plasmid
GTR15236836 1 Vial

Lentiviral mouse 4933434E20Rik shRNA (UAS) - Lentiviral mouse 4933434E20Rik shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Flecainide hydrochloride
E4893-5mg 5 mg

Flecainide hydrochloride

Sign In for Pricing
View Details
Slitrk3 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3894402 1.0 µg DNA

Slitrk3 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Anti-Neurofilament heavy polypeptide Mouse mAb
GB12144 100 μL

Anti-Neurofilament heavy polypeptide Mouse mAb

Sign In for Pricing
View Details