Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rab27b Peptide - C-terminal region

Rab27b Peptide - C-terminal region

Product Specifications

Product Name Alternative

2310021G14Rik, B130064M09Rik

UniProt

Q99P58

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rab27b Rabbit Polyclonal Antibody (orb583219) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_085031

Preservative

Lyophilized powder

AA Sequence

YCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSAATGQNVE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Solute carrier family 22 member 12 (SLC22A12) Human ELISA Kit
H2046 96 Tests

Solute carrier family 22 member 12 (SLC22A12) Human ELISA Kit

Sign In for Pricing
View Details
IGKV3D-34 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV765165 1.0 µg DNA

IGKV3D-34 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Zfp385b 3'UTR Luciferase Stable Cell Line
TU122693 1.0 mL

Zfp385b 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
FANCB Rabbit Monoclonal Antibody
E10G21381 100 µL

FANCB Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
BC062588 ORF Vector (Human) (pORF)
13177011 1.0 µg DNA

BC062588 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Olfr1512 Mouse shRNA Lentiviral Particle (Locus ID 258424)
TL511771V 500 µL Each

Olfr1512 Mouse shRNA Lentiviral Particle (Locus ID 258424)

Sign In for Pricing
View Details