Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB2B Peptide - C-terminal region

RAB2B Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ14824

UniProt

Q8WUD1

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAB2B Rabbit Polyclonal Antibody (orb331103) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_116235

Preservative

Lyophilized powder

AA Sequence

NTAKEIYRKIQQGLFDVHNEANGIKIGPQQSISTSVGPSASQRNSRDIGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ddr1 / Epithelial discoidin domain-containing receptor 1 Recombinant Protein
R15103m 1 Each

Mouse Ddr1 / Epithelial discoidin domain-containing receptor 1 Recombinant Protein

Sign In for Pricing
View Details
FKBP1A Recombinant Antibody
bsm-61448R-TR 20 µL

FKBP1A Recombinant Antibody

Sign In for Pricing
View Details
Tas2r118 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV673423 1.0 µg DNA

Tas2r118 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
AKR1A1, Sus scrofa
HY-P703415 1 Each

AKR1A1, Sus scrofa

Sign In for Pricing
View Details
CD298 rabbit pAb Antibody
orb767228-01 50 μL

CD298 rabbit pAb Antibody

Sign In for Pricing
View Details
CD298 rabbit pAb Antibody
orb767228-02 100 µL

CD298 rabbit pAb Antibody

Sign In for Pricing
View Details