Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB2B Peptide - C-terminal region

RAB2B Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ14824

UniProt

Q8WUD1

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAB2B Rabbit Polyclonal Antibody (orb331103) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_116235

Preservative

Lyophilized powder

AA Sequence

NTAKEIYRKIQQGLFDVHNEANGIKIGPQQSISTSVGPSASQRNSRDIGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MVD Peptide - N-terminal region (AAP61094)
AAP61094-100UG 100 µg

MVD Peptide - N-terminal region (AAP61094)

Sign In for Pricing
View Details
Recombinant Yersinia pestis bv. Antiqua Autoinducer 2 import system permease protein lsrD (lsrD), partial
MBS1108630-01 1 mg (E-Coli)

Recombinant Yersinia pestis bv. Antiqua Autoinducer 2 import system permease protein lsrD (lsrD), partial

Sign In for Pricing
View Details
Recombinant Yersinia pestis bv. Antiqua Autoinducer 2 import system permease protein lsrD (lsrD), partial
MBS1108630-02 1 mg (Yeast)

Recombinant Yersinia pestis bv. Antiqua Autoinducer 2 import system permease protein lsrD (lsrD), partial

Sign In for Pricing
View Details
WDR77 Mouse Monoclonal Antibody [Clone ID: OTI5H9]
TA809827S 30 µL

WDR77 Mouse Monoclonal Antibody [Clone ID: OTI5H9]

Sign In for Pricing
View Details
Protein Spindly
AP87697-01 50 µg

Protein Spindly

Sign In for Pricing
View Details
Protein Spindly
AP87697-02 100 µg

Protein Spindly

Sign In for Pricing
View Details