Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB35 Peptide - middle region

RAB35 Peptide - middle region

Product Specifications

Product Name Alternative

H-ray, RAB1C, RAY

UniProt

Q15286

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAB35 Rabbit Polyclonal Antibody (orb581643) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006852

Preservative

Lyophilized powder

AA Sequence

RTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLEC9A (1F6), 1mg/mL
BNUM2209-50 1x 50 µL

CLEC9A (1F6), 1mg/mL

Sign In for Pricing
View Details
ZK 168281-d4
TRC-Z485812-10MG 10 mg

ZK 168281-d4

Sign In for Pricing
View Details
EIF4EBP2 Polyclonal Antibody
E-AB-14802-01 20 µL

EIF4EBP2 Polyclonal Antibody

Sign In for Pricing
View Details
EIF4EBP2 Polyclonal Antibody
E-AB-14802-02 60 µL

EIF4EBP2 Polyclonal Antibody

Sign In for Pricing
View Details
EIF4EBP2 Polyclonal Antibody
E-AB-14802-03 120 µL

EIF4EBP2 Polyclonal Antibody

Sign In for Pricing
View Details
EIF4EBP2 Polyclonal Antibody
E-AB-14802-04 200 µL

EIF4EBP2 Polyclonal Antibody

Sign In for Pricing
View Details