Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB35 Peptide - middle region

RAB35 Peptide - middle region

Product Specifications

Product Name Alternative

H-ray, RAB1C, RAY

UniProt

Q15286

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAB35 Rabbit Polyclonal Antibody (orb581644) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006852

Preservative

Lyophilized powder

AA Sequence

GIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPI10 Antibody
orb846534 2 mg

GPI10 Antibody

Sign In for Pricing
View Details
HIF-1 beta Polyclonal Antibody Cy5 Conjugated
MBS9460647-01 0.1 mL

HIF-1 beta Polyclonal Antibody Cy5 Conjugated

Sign In for Pricing
View Details
HIF-1 beta Polyclonal Antibody Cy5 Conjugated
MBS9460647-02 5x 0.1 mL

HIF-1 beta Polyclonal Antibody Cy5 Conjugated

Sign In for Pricing
View Details
(3-Bromo-2,5-dimethylphenyl) methanol
XJA57534-01 50 mg

(3-Bromo-2,5-dimethylphenyl) methanol

Sign In for Pricing
View Details
(3-Bromo-2,5-dimethylphenyl) methanol
XJA57534-02 0.5 g

(3-Bromo-2,5-dimethylphenyl) methanol

Sign In for Pricing
View Details
Lentiviral mouse Phkb shRNA (UAS) - Lentiviral mouse Phkb shRNA (UAS, RFP) plasmid
GTR15246289 1 Vial

Lentiviral mouse Phkb shRNA (UAS) - Lentiviral mouse Phkb shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details