Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB35 Peptide - middle region

RAB35 Peptide - middle region

Product Specifications

Product Name Alternative

H-ray, RAB1C, RAY

UniProt

Q15286

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAB35 Rabbit Polyclonal Antibody (orb581644) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006852

Preservative

Lyophilized powder

AA Sequence

GIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal NDUFA2 Antibody [Alexa Fluor 532]
NBP2-98531AF532 0.1 mL

Rabbit Polyclonal NDUFA2 Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details
3- (Chloromethyl) -4-methoxypyridine hydrochloride
DXC60429-01 50 mg

3- (Chloromethyl) -4-methoxypyridine hydrochloride

Sign In for Pricing
View Details
3- (Chloromethyl) -4-methoxypyridine hydrochloride
DXC60429-02 0.5 g

3- (Chloromethyl) -4-methoxypyridine hydrochloride

Sign In for Pricing
View Details
Lentiviral mouse Ankrd16 shRNA (UAS) - Lentiviral mouseAnkrd16 shRNA (UAS, GFP) (25)
GTR15287384 1 Vial

Lentiviral mouse Ankrd16 shRNA (UAS) - Lentiviral mouseAnkrd16 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
AGO2 (1-200) Human
32-13021-10 10 µg

AGO2 (1-200) Human

Sign In for Pricing
View Details
Daxx Rabbit mAb
E45R11679N-50 50 µL

Daxx Rabbit mAb

Sign In for Pricing
View Details