Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB37 Peptide - middle region

RAB37 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ30284, FLJ32507

UniProt

Q8IWA7

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAB37 Rabbit Polyclonal Antibody (orb582863) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_783865

Preservative

Lyophilized powder

AA Sequence

ERVIRSEDGETLAREYGVPFLETSAKTGMNVELAFLAIAKELKYRAGHQA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CREB1 Protein Lysate (Rat) with C-HA Tag
16809037 100 µg

CREB1 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
PLV3-U6-FLOT2-shRNA1-CopGFP-Puro Plasmid
PVT73601 2 µg

PLV3-U6-FLOT2-shRNA1-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
Anti-NRP1/VEGF165R/CD304 Antibody (Vesencumab)
F1368-50 50 mg

Anti-NRP1/VEGF165R/CD304 Antibody (Vesencumab)

Sign In for Pricing
View Details
Olr1233 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7417906 1.0 µg DNA

Olr1233 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
SCN4A Rabbit Polyclonal Antibody (APC)
orb997872 100 µL

SCN4A Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Rabbit Monoclonal GAD2/GAD65 Antibody (GAD2/6488R) [DyLight 350]
NBP3-20859UV 0.1 mL

Rabbit Monoclonal GAD2/GAD65 Antibody (GAD2/6488R) [DyLight 350]

Sign In for Pricing
View Details