Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB37 Peptide - middle region

RAB37 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ30284, FLJ32507

UniProt

Q8IWA7

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAB37 Rabbit Polyclonal Antibody (orb582864) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_783865

Preservative

Lyophilized powder

AA Sequence

SAKTGMNVELAFLAIAKELKYRAGHQADEPSFQIRDYVESQKKRSSCCSF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tert-Butyl 4- (2-aminophenyl) piperidine-1-carboxylate
OR321396 1 Each

Tert-Butyl 4- (2-aminophenyl) piperidine-1-carboxylate

Sign In for Pricing
View Details
GJA1P1 3'UTR Lenti-reporter-Luc Vector
21534081 1.0 µg

GJA1P1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Aminoadipate Semialdehyde Synthase (AASS)
MBS2068588-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Aminoadipate Semialdehyde Synthase (AASS)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Aminoadipate Semialdehyde Synthase (AASS)
MBS2068588-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Aminoadipate Semialdehyde Synthase (AASS)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Aminoadipate Semialdehyde Synthase (AASS)
MBS2068588-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to Aminoadipate Semialdehyde Synthase (AASS)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Aminoadipate Semialdehyde Synthase (AASS)
MBS2068588-04 1 mL

APC/CY7-Linked Polyclonal Antibody to Aminoadipate Semialdehyde Synthase (AASS)

Sign In for Pricing
View Details