Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB37 Peptide - middle region

RAB37 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ30284, FLJ32507

UniProt

Q8IWA7

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAB37 Rabbit Polyclonal Antibody (orb582864) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_783865

Preservative

Lyophilized powder

AA Sequence

SAKTGMNVELAFLAIAKELKYRAGHQADEPSFQIRDYVESQKKRSSCCSF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Prodh qPCR Primer Pair
QM19378S 200 Tests

Mouse Prodh qPCR Primer Pair

Sign In for Pricing
View Details
Mouse Monoclonal FCRN/FCGRT Antibody (937508) [Alexa Fluor 700]
FAB8639N 0.1 mL

Mouse Monoclonal FCRN/FCGRT Antibody (937508) [Alexa Fluor 700]

Sign In for Pricing
View Details
AKT1 Overexpression Lysate (Native) - (Dry Ice)
NBL1-07441 0.1 mg

AKT1 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
FAM22G 3'UTR Luciferase Stable Cell Line
TU007268 1.0 mL

FAM22G 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
TEX2, ID (TEX2, KIAA1738, Testis-expressed sequence 2 protein) (MaxLight 750)
MBS6354918-01 0.1 mL

TEX2, ID (TEX2, KIAA1738, Testis-expressed sequence 2 protein) (MaxLight 750)

Sign In for Pricing
View Details
TEX2, ID (TEX2, KIAA1738, Testis-expressed sequence 2 protein) (MaxLight 750)
MBS6354918-02 5x 0.1 mL

TEX2, ID (TEX2, KIAA1738, Testis-expressed sequence 2 protein) (MaxLight 750)

Sign In for Pricing
View Details