Rab5c Peptide - C-terminal region
Rab5c Peptide - C-terminal region
Product Specifications
Product Name Alternative
AI326010, Rabl
UniProt
Q8C266
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Rab5c Rabbit Polyclonal Antibody (orb583726) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_077776
Preservative
Lyophilized powder
AA Sequence
FARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![STAT3 Mouse Monoclonal Antibody [Clone ID: 7G3H4]](https://cdn.genprice.uk/products/937/68dd189a061270361e8fbd49/imageurl/am06296su-n.webp)
AM06296SU-N 100 µL
STAT3 Mouse Monoclonal Antibody [Clone ID: 7G3H4]
Sign In for Pricing
View Details 
BNC740315-500 1x 500 µL
Heparan Sulphate Proteoglycan (A7L6), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041143-100 1x 100 µL
Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1125+ ARG1/1126), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 