Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rab5c Peptide - C-terminal region

Rab5c Peptide - C-terminal region

Product Specifications

Product Name Alternative

AI326010, Rabl

UniProt

Q8C266

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rab5c Rabbit Polyclonal Antibody (orb583726) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_077776

Preservative

Lyophilized powder

AA Sequence

FARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Irisin ELISA Kit
E-EL-R2625-01 24 Tests

Rat Irisin ELISA Kit

Sign In for Pricing
View Details
Rat Irisin ELISA Kit
E-EL-R2625-02 48 Tests

Rat Irisin ELISA Kit

Sign In for Pricing
View Details
Rat Irisin ELISA Kit
E-EL-R2625-03 96 Tests

Rat Irisin ELISA Kit

Sign In for Pricing
View Details
Uncoated Human TG (Thyroglobulin) ELISA Kit
E-UNEL-H0009-01 5x 96 Tests

Uncoated Human TG (Thyroglobulin) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human TG (Thyroglobulin) ELISA Kit
E-UNEL-H0009-02 15x 96 Tests

Uncoated Human TG (Thyroglobulin) ELISA Kit

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS504762 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details