Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB5C Peptide - middle region

RAB5C Peptide - middle region

Product Specifications

Product Name Alternative

MGC117217, MGC138857, RAB5CL, RABL, L1880, RAB5L

UniProt

Q5R7L7

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAB5C Rabbit Polyclonal Antibody (orb583727) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004574

Preservative

Lyophilized powder

AA Sequence

KTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARPC5L Protein Vector (Human) (pPB-N-His)
PV002594 500 ng

ARPC5L Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
5930431H10 Peptide - C-terminal region
orb2011974 100 µg

5930431H10 Peptide - C-terminal region

Sign In for Pricing
View Details
Epiregulin (EREG) Recombinant, Human
154454-01 10 µg

Epiregulin (EREG) Recombinant, Human

Sign In for Pricing
View Details
Epiregulin (EREG) Recombinant, Human
154454-02 50 µg

Epiregulin (EREG) Recombinant, Human

Sign In for Pricing
View Details
Epiregulin (EREG) Recombinant, Human
154454-03 200 µg

Epiregulin (EREG) Recombinant, Human

Sign In for Pricing
View Details
Anti-UGT1A6 Antibody Picoband® (Biotine Conjugate)
A02239-2-Biotin 100 µg/Vial

Anti-UGT1A6 Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details