RAB5C Peptide - middle region
RAB5C Peptide - middle region
Product Specifications
Product Name Alternative
MGC117217, MGC138857, RAB5CL, RABL, L1880, RAB5L
UniProt
Q5R7L7
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RAB5C Rabbit Polyclonal Antibody (orb583727) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_004574
Preservative
Lyophilized powder
AA Sequence
KTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC471683-100 1x 100 µL
Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1683), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC683019-100 1x 100 µL
CD47 / IAP (Integrin Associated Protein) (CD47/3019), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741578-100 1x 100 µL
SREBP1 (SREBP1/1578), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740205-500 1x 500 µL
Complement C4d (C4D205), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details