Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB6C Peptide - middle region

RAB6C Peptide - middle region

Product Specifications

Product Name Alternative

WTH3

UniProt

Q9H0N0

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAB6C Rabbit Polyclonal Antibody (orb584702) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115520

Preservative

Lyophilized powder

AA Sequence

DVIITLVGNRTDLADKRQVSVEEGERKAKGLNVTFIETRAKAGYNVKQLF

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGF2 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-0015R-BF647-01 20 µL

IGF2 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
IGF2 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-0015R-BF647-02 100 µL

IGF2 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
2-Iodoresorcinol
sc-485004 1 g

2-Iodoresorcinol

Sign In for Pricing
View Details
Urocortin 3 (UCN3) Recombinant, Mouse
157271-01 10 µg

Urocortin 3 (UCN3) Recombinant, Mouse

Sign In for Pricing
View Details
Urocortin 3 (UCN3) Recombinant, Mouse
157271-02 50 µg

Urocortin 3 (UCN3) Recombinant, Mouse

Sign In for Pricing
View Details
Urocortin 3 (UCN3) Recombinant, Mouse
157271-03 200 µg

Urocortin 3 (UCN3) Recombinant, Mouse

Sign In for Pricing
View Details