Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB6C Peptide - middle region

RAB6C Peptide - middle region

Product Specifications

Product Name Alternative

WTH3

UniProt

Q9H0N0

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAB6C Rabbit Polyclonal Antibody (orb584702) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115520

Preservative

Lyophilized powder

AA Sequence

DVIITLVGNRTDLADKRQVSVEEGERKAKGLNVTFIETRAKAGYNVKQLF

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF180 Antibody - N-terminal region
OAAB00821-400UL 400 µL

ZNF180 Antibody - N-terminal region

Sign In for Pricing
View Details
TAL-1 (Phospho-Ser122) Polyclonal Conjugated Antibody
orb1630742 100 µL

TAL-1 (Phospho-Ser122) Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Rabbit Procollagen Type III ELISA Kit
MBS724958-01 48 Well

Rabbit Procollagen Type III ELISA Kit

Sign In for Pricing
View Details
Rabbit Procollagen Type III ELISA Kit
MBS724958-02 96 Well

Rabbit Procollagen Type III ELISA Kit

Sign In for Pricing
View Details
Rabbit Procollagen Type III ELISA Kit
MBS724958-03 5x 96 Well

Rabbit Procollagen Type III ELISA Kit

Sign In for Pricing
View Details
Rabbit Procollagen Type III ELISA Kit
MBS724958-04 10x 96 Well

Rabbit Procollagen Type III ELISA Kit

Sign In for Pricing
View Details