Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB8B Peptide - C-terminal region

RAB8B Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ38125

UniProt

Q92930

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAB8B Rabbit Polyclonal Antibody (orb584412) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057614

Preservative

Lyophilized powder

AA Sequence

FETLTCSSGTLRTLRLKIDDFNDELNKLLEEIEEKNPQLIIDTEKHHPWA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HBLD1 (ISCA2) activation kit by CRISPRa
GA114794 1 Kit

Human HBLD1 (ISCA2) activation kit by CRISPRa

Sign In for Pricing
View Details
Cyclophilin 40 (PPID) (NM_005038) Human Over-expression Lysate
LC401561 20 µg

Cyclophilin 40 (PPID) (NM_005038) Human Over-expression Lysate

Sign In for Pricing
View Details
HMGXB3 (NM_014983) Human Recombinant Protein
TP326817 20 µg

HMGXB3 (NM_014983) Human Recombinant Protein

Sign In for Pricing
View Details
p-Cresol-d7
TRC-C781902-25MG 25 mg

p-Cresol-d7

Sign In for Pricing
View Details
CLPP Antibody
KC-16859-01 50 μL

CLPP Antibody

Sign In for Pricing
View Details
CLPP Antibody
KC-16859-02 100 µL

CLPP Antibody

Sign In for Pricing
View Details