Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB8B Peptide - C-terminal region

RAB8B Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ38125

UniProt

Q92930

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAB8B Rabbit Polyclonal Antibody (orb584412) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057614

Preservative

Lyophilized powder

AA Sequence

FETLTCSSGTLRTLRLKIDDFNDELNKLLEEIEEKNPQLIIDTEKHHPWA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSPA4L (C-term) Rabbit Polyclonal Antibody
AP18058PU-N 400 µL

HSPA4L (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
1-Bromoethyl Acetate (~90%)
TRC-B684305-10G 10 g

1-Bromoethyl Acetate (~90%)

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS801250 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Polyvinyl Alcohol
TRC-P699323-5G 5 g

Polyvinyl Alcohol

Sign In for Pricing
View Details
Alkbh6 (BC029805) Mouse Tagged ORF Clone
MG201467 10 µg

Alkbh6 (BC029805) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
8-Bromoguanosine-13C2,15N
TRC-B684366-2.5MG 2.5 mg

8-Bromoguanosine-13C2,15N

Sign In for Pricing
View Details