Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB9A Peptide - middle region

RAB9A Peptide - middle region

Product Specifications

Product Name Alternative

RAB9

UniProt

P51151

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAB9A Rabbit Polyclonal Antibody (orb579669) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004242

Preservative

Lyophilized powder

AA Sequence

SLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPFV

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Propoxypyridin-4-amine hydrochloride
FP184443-01 1 g

2-Propoxypyridin-4-amine hydrochloride

Sign In for Pricing
View Details
2-Propoxypyridin-4-amine hydrochloride
FP184443-02 2 g

2-Propoxypyridin-4-amine hydrochloride

Sign In for Pricing
View Details
2-Propoxypyridin-4-amine hydrochloride
FP184443-03 5 g

2-Propoxypyridin-4-amine hydrochloride

Sign In for Pricing
View Details
2-Propoxypyridin-4-amine hydrochloride
FP184443-04 10 g

2-Propoxypyridin-4-amine hydrochloride

Sign In for Pricing
View Details
CAV1 Protein Lysate (Mouse) with C-HA Tag
15098034 100 µg

CAV1 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
GLYAT antibody - N-terminal region (ARP48682_P050)
ARP48682_P050 100 µL

GLYAT antibody - N-terminal region (ARP48682_P050)

Sign In for Pricing
View Details