Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rab9b Peptide - N-terminal region

Rab9b Peptide - N-terminal region

Product Specifications

Product Name Alternative

9330195C02Rik, MGC130383

UniProt

Q8BHH2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rab9b Rabbit Polyclonal Antibody (orb583359) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_795945

Preservative

Lyophilized powder

AA Sequence

LQIWDTAGQERFKSLRTPFYRGADCCLLTFSVDDRQSFENLGNWQKEFIY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-MGARP Antibody Picoband® Fluoro550 Conjugated
A09345-2-Fluoro550 100 µg/Vial

Anti-MGARP Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
COOH-PEG-HZ, 5K
HE017019-5K Inquire

COOH-PEG-HZ, 5K

Sign In for Pricing
View Details
PTCD3 shRNA (m) Lentiviral Particles
sc-152573-V 200 µL

PTCD3 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
ROS1 Rabbit Polyclonal Antibody (Biotin)
orb114342 100 µL

ROS1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Human UBE3A (Ubiquitin Protein Ligase E3A) ValidElisa Kit
EK340648 96 Well

Human UBE3A (Ubiquitin Protein Ligase E3A) ValidElisa Kit

Sign In for Pricing
View Details
CD21 Antibody
orb1824264-01 20 µg

CD21 Antibody

Sign In for Pricing
View Details