Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rab9b Peptide - N-terminal region

Rab9b Peptide - N-terminal region

Product Specifications

Product Name Alternative

9330195C02Rik, MGC130383

UniProt

Q8BHH2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rab9b Rabbit Polyclonal Antibody (orb583359) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_795945

Preservative

Lyophilized powder

AA Sequence

LQIWDTAGQERFKSLRTPFYRGADCCLLTFSVDDRQSFENLGNWQKEFIY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tryptophan Hydroxylase (TPH1) (NM_004179) Human Recombinant Protein
TP321254L 1 mg

Tryptophan Hydroxylase (TPH1) (NM_004179) Human Recombinant Protein

Sign In for Pricing
View Details
Survivin (71G4B7) Rabbit Monoclonal Antibody (PE Conjugate)
CST 5875S 100 µL

Survivin (71G4B7) Rabbit Monoclonal Antibody (PE Conjugate)

Sign In for Pricing
View Details
GSTM7 siRNA (Mouse)
MBS8232232-01 15 nmol

GSTM7 siRNA (Mouse)

Sign In for Pricing
View Details
GSTM7 siRNA (Mouse)
MBS8232232-02 30 nmol

GSTM7 siRNA (Mouse)

Sign In for Pricing
View Details
GSTM7 siRNA (Mouse)
MBS8232232-03 5x 30 nmol

GSTM7 siRNA (Mouse)

Sign In for Pricing
View Details
VEGFA, ID (VEGFA, VEGF, Vascular endothelial growth factor A, Vascular permeability factor) (Azide free) (HRP) discontinued
043741-HRP 200 µL

VEGFA, ID (VEGFA, VEGF, Vascular endothelial growth factor A, Vascular permeability factor) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details