Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rab9b Peptide - N-terminal region

Rab9b Peptide - N-terminal region

Product Specifications

Product Name Alternative

9330195C02Rik, MGC130383

UniProt

Q8BHH2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rab9b Rabbit Polyclonal Antibody (orb583359) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_795945

Preservative

Lyophilized powder

AA Sequence

LQIWDTAGQERFKSLRTPFYRGADCCLLTFSVDDRQSFENLGNWQKEFIY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Influenza A H1N1 Hemagglutinin Antibody (2F1A7) [HRP]
NBP3-06443H 0.1 mL

Mouse Monoclonal Influenza A H1N1 Hemagglutinin Antibody (2F1A7) [HRP]

Sign In for Pricing
View Details
pLV3-U6-VAV1-shRNA3-CopGFP-Puro Plasmid
PVT48161 2 µg

pLV3-U6-VAV1-shRNA3-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
Recombinant Human COMM Domain Containing 6
MBS140942-01 0.005 mg

Recombinant Human COMM Domain Containing 6

Sign In for Pricing
View Details
Recombinant Human COMM Domain Containing 6
MBS140942-02 0.02 mg

Recombinant Human COMM Domain Containing 6

Sign In for Pricing
View Details
Recombinant Human COMM Domain Containing 6
MBS140942-03 1 mg

Recombinant Human COMM Domain Containing 6

Sign In for Pricing
View Details
Recombinant Human COMM Domain Containing 6
MBS140942-04 5x 1 mg

Recombinant Human COMM Domain Containing 6

Sign In for Pricing
View Details