Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB9B Peptide - N-terminal region

RAB9B Peptide - N-terminal region

Product Specifications

Product Name Alternative

RAB9L, Rab-9L

UniProt

Q9NP90

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAB9B Rabbit Polyclonal Antibody (orb583358) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057454

Preservative

Lyophilized powder

AA Sequence

KSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQIWDTAGQERF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCBP2 (NM_031989) Human Over-expression Lysate
LY403134 100 µg

PCBP2 (NM_031989) Human Over-expression Lysate

Sign In for Pricing
View Details
HGS Rabbit Polyclonal Antibody
AP20247PU-N 100 µg

HGS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS505053 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
HUS1 (NM_004507) Human Over-expression Lysate
LY401435 100 µg

HUS1 (NM_004507) Human Over-expression Lysate

Sign In for Pricing
View Details
ADCK4 (COQ8B) (NM_024876) Human Over-expression Lysate
LY403036 100 µg

ADCK4 (COQ8B) (NM_024876) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Vimentin Monoclonal Antibody
AN300290P 100 µL

Recombinant Vimentin Monoclonal Antibody

Sign In for Pricing
View Details