RAB9B Peptide - N-terminal region
RAB9B Peptide - N-terminal region
Product Specifications
Product Name Alternative
RAB9L, Rab-9L
UniProt
Q9NP90
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RAB9B Rabbit Polyclonal Antibody (orb583358) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_057454
Preservative
Lyophilized powder
AA Sequence
KSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQIWDTAGQERF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AP31202PU-N 50 µg
Smad Interacting Protein 1 (ZEB2) (C-term) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details ![Elab Fluor® 700 Anti-Mouse CD16/32 Antibody[2.4G2]](https://cdn.genprice.uk/products/763/68dd149f061270361e7d059f/imageurl/e-ab-f0997m1.webp)
E-AB-F0997M1-01 50 Tests
Elab Fluor® 700 Anti-Mouse CD16/32 Antibody[2.4G2]
Sign In for Pricing
View Details E-AB-F0997M1-02 100 Tests
Elab Fluor® 700 Anti-Mouse CD16/32 Antibody[2.4G2]
Sign In for Pricing
View Details E-AB-F0997M1-03 2x 100 Tests
Elab Fluor® 700 Anti-Mouse CD16/32 Antibody[2.4G2]
Sign In for Pricing
View Details 
