Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RABEPK Peptide - N-terminal region

RABEPK Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp686P1077, RAB9P40, bA65N13.1, p40

UniProt

Q7Z6M1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RABEPK Rabbit Polyclonal Antibody (orb581579) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005824

Preservative

Lyophilized powder

AA Sequence

SCSYLPPVGNAKRGKVFIVGGANPNRSFSDVHTMDLGKHQWDLDTCKGLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-N, N-Diphenylamino-b-phenylstilbene
272821-01 500 mg

4-N, N-Diphenylamino-b-phenylstilbene

Sign In for Pricing
View Details
4-N, N-Diphenylamino-b-phenylstilbene
272821-02 1 g

4-N, N-Diphenylamino-b-phenylstilbene

Sign In for Pricing
View Details
4-N, N-Diphenylamino-b-phenylstilbene
272821-03 2 g

4-N, N-Diphenylamino-b-phenylstilbene

Sign In for Pricing
View Details
4-N, N-Diphenylamino-b-phenylstilbene
272821-04 5 g

4-N, N-Diphenylamino-b-phenylstilbene

Sign In for Pricing
View Details
4-N, N-Diphenylamino-b-phenylstilbene
272821-05 10 g

4-N, N-Diphenylamino-b-phenylstilbene

Sign In for Pricing
View Details
Recombinant Human CXCR3
P2362-01 50 µg

Recombinant Human CXCR3

Sign In for Pricing
View Details