RAD17 Peptide - N-terminal region
RAD17 Peptide - N-terminal region
Product Specifications
Product Name Alternative
CCYC, FLJ41520, HRAD17, R24L, RAD17SP, RAD24
UniProt
O75943
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RAD17 Rabbit Polyclonal Antibody (orb573645) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_002864
Preservative
Lyophilized powder
AA Sequence
MNQVTDWVDPSFDDFLECSGVSTITATSLGVNNSSHRRKNGPSTLESSRF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![APC Anti-Mouse CD23 Antibody[B3B4]](https://cdn.genprice.uk/products/763/68dd1496061270361e7cdbd5/imageurl/e-ab-f1178ue.webp)
![PGBD5 Mouse Monoclonal Antibody [7-F8-5]](https://cdn.genprice.uk/products/992/68dd1c8b061270361ea818e9/imageurl/m1012-1.webp)
TRC-D444628-50MG 50 mg
N,N-Diethyl-3-(mesitylsulphonyl)-1H-1,2,4-triazole-1-carboximidamide (Cafenstrole)
Sign In for Pricing
View Details 
BNC942558-500 1x 500 µL
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIGHM/2558), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
KN212694RB 1 Kit
Nesprin 1 (SYNE1) Human Gene Knockout Kit (CRISPR)
Sign In for Pricing
View Details