Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAD17 Peptide - N-terminal region

RAD17 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CCYC, FLJ41520, HRAD17, R24L, RAD17SP, RAD24

UniProt

O75943

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAD17 Rabbit Polyclonal Antibody (orb573645) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002864

Preservative

Lyophilized powder

AA Sequence

MNQVTDWVDPSFDDFLECSGVSTITATSLGVNNSSHRRKNGPSTLESSRF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prr32 Mouse Gene Knockout Kit (CRISPR)
KN500032 1 Kit

Prr32 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD69 Antibody[FN50]
E-AB-F1138M-01 20 Tests

Elab Fluor® 647 Anti-Human CD69 Antibody[FN50]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD69 Antibody[FN50]
E-AB-F1138M-02 100 Tests

Elab Fluor® 647 Anti-Human CD69 Antibody[FN50]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD69 Antibody[FN50]
E-AB-F1138M-03 2x 100 Tests

Elab Fluor® 647 Anti-Human CD69 Antibody[FN50]

Sign In for Pricing
View Details
Carbetocin
TRC-C175925-10MG 10 mg

Carbetocin

Sign In for Pricing
View Details
Shugoshin (SGO1) (NM_001012410) Human Over-expression Lysate
LY422848 100 µg

Shugoshin (SGO1) (NM_001012410) Human Over-expression Lysate

Sign In for Pricing
View Details