Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAD18 Peptide - middle region

RAD18 Peptide - middle region

Product Specifications

Product Name Alternative

RNF73

UniProt

Q9NS91

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAD18 Rabbit Polyclonal Antibody (orb330293) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_064550

Preservative

Lyophilized powder

AA Sequence

LSDRDLKKKLKEHGLSIQGNKQQLIKRHQEFVHMYNAQCDALHPKSAAEI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal VEGF Antibody (VEGFA/7758R) [Janelia Fluor 585]
NBP3-21088JF585 0.1 mL

Rabbit Monoclonal VEGF Antibody (VEGFA/7758R) [Janelia Fluor 585]

Sign In for Pricing
View Details
DDO Protein Vector (Rat) (pPM-C-HA)
PV263436 500 ng

DDO Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse EPHA2 Polyclonal Antibody
E55A04350 100 µg

Mouse EPHA2 Polyclonal Antibody

Sign In for Pricing
View Details
IFITM5 Antibody, Biotin conjugated
CSB-PA011028HD01HU-01 50 µg

IFITM5 Antibody, Biotin conjugated

Sign In for Pricing
View Details
IFITM5 Antibody, Biotin conjugated
CSB-PA011028HD01HU-02 100 µg

IFITM5 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Microdynamic Chromogenic Limulus Test Kit
T7577 90 Tests

Microdynamic Chromogenic Limulus Test Kit

Sign In for Pricing
View Details