Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAD18 Peptide - middle region

RAD18 Peptide - middle region

Product Specifications

Product Name Alternative

RNF73

UniProt

Q9NS91

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAD18 Rabbit Polyclonal Antibody (orb330293) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_064550

Preservative

Lyophilized powder

AA Sequence

LSDRDLKKKLKEHGLSIQGNKQQLIKRHQEFVHMYNAQCDALHPKSAAEI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Secretagogin Antibody (185) [DyLight 405]
NBP2-90101V 0.1 mL

Rabbit Monoclonal Secretagogin Antibody (185) [DyLight 405]

Sign In for Pricing
View Details
81 Pos Microcentrifuge Tube Freezer Rack with lid Assorted
LW5700AS 5 / PCK

81 Pos Microcentrifuge Tube Freezer Rack with lid Assorted

Sign In for Pricing
View Details
Recombinant Mouse Basigin/CD147 (C-6His)
orb1648084-01 10 µg

Recombinant Mouse Basigin/CD147 (C-6His)

Sign In for Pricing
View Details
Recombinant Mouse Basigin/CD147 (C-6His)
orb1648084-02 50 µg

Recombinant Mouse Basigin/CD147 (C-6His)

Sign In for Pricing
View Details
Recombinant Mouse Basigin/CD147 (C-6His)
orb1648084-03 500 µg

Recombinant Mouse Basigin/CD147 (C-6His)

Sign In for Pricing
View Details
Recombinant Mouse Basigin/CD147 (C-6His)
orb1648084-04 1 mg

Recombinant Mouse Basigin/CD147 (C-6His)

Sign In for Pricing
View Details