Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rad21 Peptide - N-terminal region

Rad21 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC116373, Rad21

UniProt

Q4KLH7

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rad21 Rabbit Polyclonal Antibody (orb583278) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001020872

Preservative

Lyophilized powder

AA Sequence

EDDDMLVSTSASNLLLEPEQSTSNLNEKINHLEYEDQYKDDNFGEGNDGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Milk Fat Globulin (MFG-06), 1mg/mL
BNUM0227-50 1x 50 µL

Milk Fat Globulin (MFG-06), 1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Duodenum
CR559428 5 µg

Tissue Total RNA, Duodenum

Sign In for Pricing
View Details
Srsf12 Mouse Gene Knockout Kit (CRISPR)
KN516743 1 Kit

Srsf12 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RWDD3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8B3]
TA811754BM 100 µL

RWDD3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8B3]

Sign In for Pricing
View Details
VEGFC (NM_005429) Human Over-expression Lysate
LC401667 20 µg

VEGFC (NM_005429) Human Over-expression Lysate

Sign In for Pricing
View Details
MEK1 (MAP2K1) Human Knockdown Lysate
LY300233 100 µg

MEK1 (MAP2K1) Human Knockdown Lysate

Sign In for Pricing
View Details