Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rad21 Peptide - C-terminal region

Rad21 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC116373, Rad21

UniProt

Q4KLH7

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rad21 Rabbit Polyclonal Antibody (orb583279) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001020872

Preservative

Lyophilized powder

AA Sequence

FSLPAQPLWNNRLLKLFTRCLTPLVPEDLRKRRKGGEADNLDEFLKEFEN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC_Cy7-Linked Monoclonal Antibody to 5-Lipoxygenase (5-LO)
MBS2149971-01 0.1 mL

APC_Cy7-Linked Monoclonal Antibody to 5-Lipoxygenase (5-LO)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to 5-Lipoxygenase (5-LO)
MBS2149971-02 0.2 mL

APC_Cy7-Linked Monoclonal Antibody to 5-Lipoxygenase (5-LO)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to 5-Lipoxygenase (5-LO)
MBS2149971-03 0.5 mL

APC_Cy7-Linked Monoclonal Antibody to 5-Lipoxygenase (5-LO)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to 5-Lipoxygenase (5-LO)
MBS2149971-04 1 mL

APC_Cy7-Linked Monoclonal Antibody to 5-Lipoxygenase (5-LO)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to 5-Lipoxygenase (5-LO)
MBS2149971-05 5 mL

APC_Cy7-Linked Monoclonal Antibody to 5-Lipoxygenase (5-LO)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to 5-Lipoxygenase (5-LO)
MBS2149971-06 5x 5 mL

APC_Cy7-Linked Monoclonal Antibody to 5-Lipoxygenase (5-LO)

Sign In for Pricing
View Details