Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rad21 Peptide - C-terminal region

Rad21 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC116373, Rad21

UniProt

Q4KLH7

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rad21 Rabbit Polyclonal Antibody (orb583279) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001020872

Preservative

Lyophilized powder

AA Sequence

FSLPAQPLWNNRLLKLFTRCLTPLVPEDLRKRRKGGEADNLDEFLKEFEN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPA Interacting Protein Peptide
orb1236441 0.05 mg

RPA Interacting Protein Peptide

Sign In for Pricing
View Details
Cyp4f1 (NM_019623) Rat Untagged Clone
RN213477 10 µg

Cyp4f1 (NM_019623) Rat Untagged Clone

Sign In for Pricing
View Details
PIC 605-DIA 200-B7541 AC Signs
254405 Card of 1 Pictogram(s)

PIC 605-DIA 200-B7541 AC Signs

Sign In for Pricing
View Details
GPC3 Antibody / Glypican 3
V5364-20UG 20 µg

GPC3 Antibody / Glypican 3

Sign In for Pricing
View Details
PHKG1 Antibody
MBS8591165-01 0.1 mg

PHKG1 Antibody

Sign In for Pricing
View Details
PHKG1 Antibody
MBS8591165-02 0.1 mL (AF405L)

PHKG1 Antibody

Sign In for Pricing
View Details