Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAD23B Peptide - middle region

RAD23B Peptide - middle region

Product Specifications

Product Name Alternative

HHR23B, HR23B, P58

UniProt

P54727

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAD23B Rabbit Polyclonal Antibody (orb583191) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002865

Preservative

Lyophilized powder

AA Sequence

QSSAVAAAAATTTATTTTTSSGGHPLEFLRNQPQFQQMRQIIQQNPSLLP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tubulin gamma Antibody
E18-7012-2 100 µg -100 µL

Tubulin gamma Antibody

Sign In for Pricing
View Details
C15orf43 Double Nickase Plasmid (m)
sc-428869-NIC 20 µg

C15orf43 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
SCGB1D1 (NM_006552) Human Tagged ORF Clone
RC209359 10 µg

SCGB1D1 (NM_006552) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rat Zinc finger protein 513, ZNF513 ELISA Kit
MBS9336308-01 48 Well

Rat Zinc finger protein 513, ZNF513 ELISA Kit

Sign In for Pricing
View Details
Rat Zinc finger protein 513, ZNF513 ELISA Kit
MBS9336308-02 96 Well

Rat Zinc finger protein 513, ZNF513 ELISA Kit

Sign In for Pricing
View Details
Rat Zinc finger protein 513, ZNF513 ELISA Kit
MBS9336308-03 5x 96 Well

Rat Zinc finger protein 513, ZNF513 ELISA Kit

Sign In for Pricing
View Details