Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAD23B Peptide - middle region

RAD23B Peptide - middle region

Product Specifications

Product Name Alternative

HHR23B, HR23B, P58

UniProt

P54727

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAD23B Rabbit Polyclonal Antibody (orb583191) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002865

Preservative

Lyophilized powder

AA Sequence

QSSAVAAAAATTTATTTTTSSGGHPLEFLRNQPQFQQMRQIIQQNPSLLP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dynorphin A (1-11) (Human, Rat, Mouse, Porcine)
021-15 500 µg

Dynorphin A (1-11) (Human, Rat, Mouse, Porcine)

Sign In for Pricing
View Details
GNAS Rabbit Polyclonal Antibody (BF680)
orb2386444 100 µL

GNAS Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
DAPK3 siRNA (Rat)
orb1832023-01 15 nmol

DAPK3 siRNA (Rat)

Sign In for Pricing
View Details
DAPK3 siRNA (Rat)
orb1832023-02 30 nmol

DAPK3 siRNA (Rat)

Sign In for Pricing
View Details
JAK2 Antibody FITC Conjugated
MBS9460096-01 0.1 mL

JAK2 Antibody FITC Conjugated

Sign In for Pricing
View Details
JAK2 Antibody FITC Conjugated
MBS9460096-02 5x 0.1 mL

JAK2 Antibody FITC Conjugated

Sign In for Pricing
View Details