RAD51AP1 Peptide - middle region
RAD51AP1 Peptide - middle region
Product Specifications
Product Name Alternative
PIR51
UniProt
A8K7D3
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RAD51AP1 Rabbit Polyclonal Antibody (orb577719) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_006470
Preservative
Lyophilized powder
AA Sequence
EDDVGGVQGKRKAASKAAAQQRKILLEGSDGDSANDTEPDFAPGEDSEDD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Elab Fluor® 488 Anti-Human CD3 Antibody[OKT-3]](https://cdn.genprice.uk/products/763/68dd14a6061270361e7d1ca6/imageurl/e-ab-f1001l.webp)
E-AB-F1001L-01 20 Tests
Elab Fluor® 488 Anti-Human CD3 Antibody[OKT-3]
Sign In for Pricing
View Details E-AB-F1001L-02 100 Tests
Elab Fluor® 488 Anti-Human CD3 Antibody[OKT-3]
Sign In for Pricing
View Details E-AB-F1001L-03 2x 100 Tests
Elab Fluor® 488 Anti-Human CD3 Antibody[OKT-3]
Sign In for Pricing
View Details 
BNC882052-500 1x 500 µL
TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/2052R), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
