Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAD51AP1 Peptide - middle region

RAD51AP1 Peptide - middle region

Product Specifications

Product Name Alternative

PIR51

UniProt

A8K7D3

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAD51AP1 Rabbit Polyclonal Antibody (orb577719) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006470

Preservative

Lyophilized powder

AA Sequence

EDDVGGVQGKRKAASKAAAQQRKILLEGSDGDSANDTEPDFAPGEDSEDD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD5 (C5/473 + CD5/54/F6), CF594 conjugate, 0.1mg/mL
BNC940748-100 1x 100 µL

CD5 (C5/473 + CD5/54/F6), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
B7-H4 (Immuno-Inhibitory Protein) (B7H4/1788), 0.2mg/mL
BNUB1788-100 1x 100 µL

B7-H4 (Immuno-Inhibitory Protein) (B7H4/1788), 0.2mg/mL

Sign In for Pricing
View Details
RASGRP 4 (RASGRP4) Human Gene Knockout Kit (CRISPR)
KN419630 1 Kit

RASGRP 4 (RASGRP4) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Capsaicin-d3 (E/Z-Mixture)
TRC-C175682-1MG 1 mg

Capsaicin-d3 (E/Z-Mixture)

Sign In for Pricing
View Details
2,2'-(2,5-Cyclohexadiene-1,4-diylidene)bis-hydrazinecarboximidamide Sulfate
TRC-C989530-50MG 50 mg

2,2'-(2,5-Cyclohexadiene-1,4-diylidene)bis-hydrazinecarboximidamide Sulfate

Sign In for Pricing
View Details
Recombinant Human TNF-alpha/TNFA Protein (aa 57-233, His Tag)
PKSH033165-01 10 µg

Recombinant Human TNF-alpha/TNFA Protein (aa 57-233, His Tag)

Sign In for Pricing
View Details