Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rag1 Peptide - C-terminal region

Rag1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Rag-1

UniProt

P15919

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rag1 Rabbit Polyclonal Antibody (orb578659) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033045

Preservative

Lyophilized powder

AA Sequence

IIERDGSIGAWASEGNESGNKLFRRFRKMNARQSKCYEMEDVLKHHWLYT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Filamin Binding LIM Protein 1 (FBLIM1) ELISA Kit
RDR-FBLIM1-Ra-01 96 Tests

Rat Filamin Binding LIM Protein 1 (FBLIM1) ELISA Kit

Sign In for Pricing
View Details
Rat Filamin Binding LIM Protein 1 (FBLIM1) ELISA Kit
RDR-FBLIM1-Ra-02 48 Tests

Rat Filamin Binding LIM Protein 1 (FBLIM1) ELISA Kit

Sign In for Pricing
View Details
Arsenazo-I Sodium Salt Hydrate
TRC-A774170-500MG 500 mg

Arsenazo-I Sodium Salt Hydrate

Sign In for Pricing
View Details
MEGF8 Antibody
8C16731-AAT 50 µg

MEGF8 Antibody

Sign In for Pricing
View Details
IL 18 Human, His
OM296680-01 10 µg

IL 18 Human, His

Sign In for Pricing
View Details
IL 18 Human, His
OM296680-02 2 µg

IL 18 Human, His

Sign In for Pricing
View Details