Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rag1 Peptide - C-terminal region

Rag1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Rag-1

UniProt

P15919

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rag1 Rabbit Polyclonal Antibody (orb578659) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033045

Preservative

Lyophilized powder

AA Sequence

IIERDGSIGAWASEGNESGNKLFRRFRKMNARQSKCYEMEDVLKHHWLYT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Phospho D-Erythronate
TRC-P355000-1MG 1 mg

4-Phospho D-Erythronate

Sign In for Pricing
View Details
SSH3BP1 (ABI1) (NM_001178125) Human Over-expression Lysate
LC432894 20 µg

SSH3BP1 (ABI1) (NM_001178125) Human Over-expression Lysate

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD162 Antibody
RD20538F-01 25 µg

PE/Cyanine5 Anti-Mouse CD162 Antibody

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD162 Antibody
RD20538F-02 100 µg

PE/Cyanine5 Anti-Mouse CD162 Antibody

Sign In for Pricing
View Details
Muscle Specific Actin (HHF35 + MSA/953), CF568 conjugate, 0.1mg/mL
BNC681013-100 1x 100 µL

Muscle Specific Actin (HHF35 + MSA/953), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Uncoated Human LDLR (Low Density Lipoprotein Receptor) ELISA Kit
E-UNEL-H0102-01 5x 96 Tests

Uncoated Human LDLR (Low Density Lipoprotein Receptor) ELISA Kit

Sign In for Pricing
View Details