RAI16 Peptide - N-terminal region
RAI16 Peptide - N-terminal region
Product Specifications
Product Name Alternative
FLJ11125, FLJ21801, MGC138352, RAI16
UniProt
Q86V87
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RAI16 Rabbit Polyclonal Antibody (orb583651) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_073586
Preservative
Lyophilized powder
AA Sequence
HYYIESTDESTPAKKTDIPWRLKQMLDILVYEEQQQAAAGEAGPCLEYLL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
S1D-C52H3-100ug 100 µg
SARS-CoV-2 (COVID-19) S1 protein CTD, His Tag (MALS verified)
Sign In for Pricing
View Details 
BNC741997-500 1x 500 µL
NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/1997R), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
AP13477PU-N 400 µL
alpha Synuclein (SNCA) (C-term) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 