Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAI16 Peptide - N-terminal region

RAI16 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ11125, FLJ21801, MGC138352, RAI16

UniProt

Q86V87

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAI16 Rabbit Polyclonal Antibody (orb583651) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_073586

Preservative

Lyophilized powder

AA Sequence

HYYIESTDESTPAKKTDIPWRLKQMLDILVYEEQQQAAAGEAGPCLEYLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EnzyLight™ ADP/ATP Ratio Assay Kit
ELDT-100 100 Tests

EnzyLight™ ADP/ATP Ratio Assay Kit

Sign In for Pricing
View Details
Arg8-Vasopressin (AVP) ELISA Kit
K049-H1 1 Plate

Arg8-Vasopressin (AVP) ELISA Kit

Sign In for Pricing
View Details
Recombinant LysRS Monoclonal Antibody
AN301592L-01 50 µL

Recombinant LysRS Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant LysRS Monoclonal Antibody
AN301592L-02 100 µL

Recombinant LysRS Monoclonal Antibody

Sign In for Pricing
View Details
a-Ionol (Technical Grade)
TRC-I731285-5G 5 g

a-Ionol (Technical Grade)

Sign In for Pricing
View Details
CD2 / Lymphocyte Function Antigen 2 (LFA-2) (UMCD2), CF594 conjugate, 0.1mg/mL
BNC940201-500 1x 500 µL

CD2 / Lymphocyte Function Antigen 2 (LFA-2) (UMCD2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details